PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr002501.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 337aa    MW: 37773.3 Da    PI: 6.0364
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr002501.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.1e-161360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l++ ++ +G g+W+++++  g+ R++k+c++rw +yl
      Pbr002501.1 13 RGLWSPEEDEKLLNHINTFGHGSWSSVPKLAGLERCGKSCRLRWINYL 60
                     788*******************************************97 PP

2Myb_DNA-binding47.63.9e-1566109146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++ E+  +vd+++ lG++ W+ Ia++++ gRt++++k++w++
      Pbr002501.1  66 RGPFSEIEERTIVDVHRILGNK-WAQIAKHLP-GRTDNEVKNFWNS 109
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-25463IPR009057Homeodomain-like
PROSITE profilePS5129416.784860IPR017930Myb domain
SuperFamilySSF466891.54E-2910107IPR009057Homeodomain-like
SMARTSM007173.5E-131262IPR001005SANT/Myb domain
PfamPF002494.8E-151360IPR001005SANT/Myb domain
CDDcd001672.86E-111660No hitNo description
PROSITE profilePS5129424.41561115IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2464116IPR009057Homeodomain-like
SMARTSM007171.5E-1465113IPR001005SANT/Myb domain
PfamPF002491.5E-1366109IPR001005SANT/Myb domain
CDDcd001679.99E-1168108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGHHCCSKQK IKRGLWSPEE DEKLLNHINT FGHGSWSSVP KLAGLERCGK SCRLRWINYL  60
RPDLKRGPFS EIEERTIVDV HRILGNKWAQ IAKHLPGRTD NEVKNFWNSC IKKKLIAQGF  120
DPNTHNLLPS SKANPSNINN NNNNIHACNM FSPSSFFSVN SSHVSADTSI DILEAPYLTL  180
PSTSSPHTNH VDISLHERST ISTCEFQNPN MVWSTTLVQE QINPIVLTEF MGINNVPTIS  240
TSHSYPISEL ENIVNESFQP ITKSTNPKDM LLQSQQEEAC EVVENENPSV LNGAQTNIDA  300
SFGSSNFDLD FMESTELPCG MYNYQPSPMD QLTWNG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29131157108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009363274.10.0PREDICTED: transcription factor MYB86-like
TrEMBLM5WLA01e-142M5WLA0_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s12240.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34663267
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.13e-81myb domain protein 67